Language:
  
[Sign in] [Register]   

EIAab logo

Index > Protein center > CTXIII(Shorten name) > Human
  • Add your favorite
  • CTXIII (Shorten name),
  • top
  • Come back to page head.
  • |
  • General Annotation
  • |
  • General Annotation
  • |
  • 3D
  • |
  • Predicted Eptitope
  • |
  • Vaild Sequence
  • |
  • Feedback
  • Shorten name:
    CTXIII;
    Antigen name:
    C-terminal telopeptide of Collagen alpha-1(III) chain;
    Alternative:

    General Annotation
    Sub Unit:
    Function:
    In bone physiology, the C-terminal telopeptide (or more formally, carboxy-terminal collagen crosslinks, and known by the acronym CTX) is a serum biomarker used to measure the rate of bone turnover. It can be useful in assisting clinicians to determine a patient's nonsurgical treatment response as well as evaluate a patient's risk of developing complications during healing following surgical intervention. The test used to detect the CTX marker is called the Serum CrossLaps, and it is more specific to bone resorption than any other test currently available.
    Location:
    Antigen Attributes:
    Formula:
    DEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDSSAEKKHVWFGESMDGGFQFSYGNPELPEDVLDVHLAFLRLLSSRASQNITYHCKNSIAYMDQASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCFL
    3D Structure:
    N/A
    Predicted Eptitope:
    Please Sign in.
    EIAab Sequence  Vaild Sequence:
    Please Sign in.
     
    FOR
    ELISA Kit for Human C-terminal telopeptide of Collagen alpha-1(III) chain
    Cat.:
    E1666h
    Price:
    Please sign in first.
    MSDS:
    Please sign in first.
    Packing:
    96T
    Range:
    Please sign in first.
    CLIA Kit for Human C-terminal telopeptide of Collagen alpha-1(III) chain
    Cat.:
    U1666h
    Price:
    Please sign in first.
    MSDS:
    Please sign in first.
    Packing:
    96T
    Range:
    Please sign in first.
    Polyclonal Antibody for Human C-terminal telopeptide of Collagen alpha-1(III) chain
    Cat.:
    P1666Rb-h
    Price:
    Please sign in first.
    Packing:
    40ug/0.2ml
    Monoclonal Antibody for Human C-terminal telopeptide of Collagen alpha-1(III) chain
    Protein for Human C-terminal telopeptide of Collagen alpha-1(III) chain

    R&D Technical Data
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    Precision
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    Recovery
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    Linearity
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    References
    Product Feedback Wall
    Hot Genes
    Top Searches
    Why choose EIAAB
    Our products have been quoted by many publications in famous journals such as Cell; Cell Metabolism; Hepatology; Biomaterials.more
    Further Information
    About us Protein center Bank account Distributors Terms & Conditions Career eiaab.com.cn

    Copyright & copy www.eiaab.com2006-2016 All Rights Reserved    EIAab         Email:eiaab@eiaab.com

    鄂ICP备10015095号-1

    鄂公网安备 42018502005535号

    Twitter