Language:
  
[Sign in] [Register]   

EIAab logo

Index > Protein center > APLN36(Shorten name) > Human
  • Add your favorite
  • APLN36 (Shorten name),
  • top
  • Come back to page head.
  • |
  • General Annotation
  • |
  • General Annotation
  • |
  • 3D
  • |
  • Predicted Eptitope
  • |
  • Vaild Sequence
  • |
  • Feedback
  • Shorten name:
    APLN36;
    Antigen name:
    Apelin-36;
    Alternative:

    General Annotation
    Sub Unit:
    Function:
    Apelin gene encodes a pre-proprotein of 77 amino acids, with a signal peptide in the N-terminal region. After translocation into the endoplasmic reticulum and cleavage of the signal peptide, the proprotein of 55 amino acids may generate several active fragments: a 36 amino acid peptide corresponding to the sequence 42-77 (apelin 36), a 17 amino acid peptide corresponding to the sequence 61-77 (apelin 17) and a 13 amino acid peptide corresponding to the sequence 65-77 (apelin 13).
    Location:
    Antigen Attributes:
    Formula:
    LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
    3D Structure:
    N/A
    Predicted Eptitope:
    Please Sign in.
    EIAab Sequence  Vaild Sequence:
    Please Sign in.
     
    FOR
    ELISA Kit for Human Apelin-36
    Cat.:
    E1865h
    Price:
    Please sign in first.
    MSDS:
    Please sign in first.
    Packing:
    96T
    Range:
    Please sign in first.
    CLIA Kit for Human Apelin-36
    Cat.:
    U1865h
    Price:
    Please sign in first.
    MSDS:
    Please sign in first.
    Packing:
    96T
    Range:
    Please sign in first.
    Polyclonal Antibody for Human Apelin-36
    Cat.:
    P1865Rb-h
    Price:
    Please sign in first.
    Packing:
    40ug/0.2ml
    Monoclonal Antibody for Human Apelin-36
    Protein for Human Apelin-36

    R&D Technical Data
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    Precision
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    Recovery
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    Linearity
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    For more information, please refer to the manual,Or contact our technical support: tech@eiaab.com.
    References
    Product Feedback Wall
    Hot Genes
    ALCAM ACE KSR2 ASPRO C19orf80 Gdf5 Trap1a Atf2
    Top Searches
    Ubiquitin ELISA Ubiquitin-protein ligase metalloproteinase Asprosin Tumor necrosis TRAP1A vitamin d
    Why choose EIAAB
    Our products have been quoted by many publications in famous journals such as Cell; Cell Metabolism; Hepatology; Biomaterials.more
    Further Information
    About us Protein center Bank account Distributors Terms & Conditions Career eiaab.cn

    Copyright & copy www.eiaab.com2006-2016 All Rights Reserved    EIAab         Email:eiaab@eiaab.com

    Twitter